Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WDR77 Rabbit Polyclonal Antibody (FITC)

WDR77 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

P44, MEP50, MEP-50, HKMT1069, Nbla10071, p44/Mep50

UniProt

Q9BQA1

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human WDR77

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MRKETPPPLVPPAAREWNLPPNAPACMERQLEAARYRSDGALLLGASSLS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_077007

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Monoclonal CD40 Ligand/TNFSF5 Antibody (208109) [DyLight 350]
FAB1163D 0.5 mL

Rat Monoclonal CD40 Ligand/TNFSF5 Antibody (208109) [DyLight 350]

Sign In for Pricing
View Details
Recombinant Prochlorococcus marinus Chaperone protein DnaK (dnaK), partial
MBS1391946 Inquire

Recombinant Prochlorococcus marinus Chaperone protein DnaK (dnaK), partial

Sign In for Pricing
View Details
AGA Rabbit Polyclonal Antibody
E10G07794 100 µL

AGA Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EIF3C Rabbit Polyclonal Antibody
orb1544677-01 50 μL

EIF3C Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EIF3C Rabbit Polyclonal Antibody
orb1544677-02 100 µL

EIF3C Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZFHX1B (Zinc Finger E-Box Binding HomeoBox 2, KIAA0569, SIP-1, SIP1, SMADIP1, ZFHX1B) (MaxLight 490)
MBS6209343-01 0.1 mL

ZFHX1B (Zinc Finger E-Box Binding HomeoBox 2, KIAA0569, SIP-1, SIP1, SMADIP1, ZFHX1B) (MaxLight 490)

Sign In for Pricing
View Details