Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WDR77 Rabbit Polyclonal Antibody (HRP)

WDR77 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P44, MEP50, MEP-50, HKMT1069, Nbla10071, p44/Mep50

UniProt

Q9BQA1

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human WDR77

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MRKETPPPLVPPAAREWNLPPNAPACMERQLEAARYRSDGALLLGASSLS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_077007

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgG1 Recombinant Antibody, AbBy Fluor™ 647 Conjugated
bsm-62753R-BF647 100 µL

Human IgG1 Recombinant Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
Mouse Anti-Canine RAD9A Monoclonal Antibody
VD11N147 1 Each

Mouse Anti-Canine RAD9A Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Thermosipho melanesiensis Endonuclease V (nfi)
MBS1251745-01 0.02 mg (E-Coli)

Recombinant Thermosipho melanesiensis Endonuclease V (nfi)

Sign In for Pricing
View Details
Recombinant Thermosipho melanesiensis Endonuclease V (nfi)
MBS1251745-02 0.1 mg (E-Coli)

Recombinant Thermosipho melanesiensis Endonuclease V (nfi)

Sign In for Pricing
View Details
Recombinant Thermosipho melanesiensis Endonuclease V (nfi)
MBS1251745-03 0.02 mg (Yeast)

Recombinant Thermosipho melanesiensis Endonuclease V (nfi)

Sign In for Pricing
View Details
Recombinant Thermosipho melanesiensis Endonuclease V (nfi)
MBS1251745-04 0.1 mg (Yeast)

Recombinant Thermosipho melanesiensis Endonuclease V (nfi)

Sign In for Pricing
View Details