Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cpa5 Rabbit Polyclonal Antibody (HRP)

Cpa5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MGC94525

UniProt

Q9H633

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PGLSPVDRRTLLFCNFILAVAWGQVNFTGDQVLRVLAKNEKQLSLLRDLE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_001186050

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

14-3-3, beta, Recombinant, Human (Protein 1054, Protein Kinase C Inhibitor Protein 1, KCIP-1, 14-3-3 Protein beta/alpha, N-terminally Processed, YWHAB) discontinued
0014-02R 500 µg

14-3-3, beta, Recombinant, Human (Protein 1054, Protein Kinase C Inhibitor Protein 1, KCIP-1, 14-3-3 Protein beta/alpha, N-terminally Processed, YWHAB) discontinued

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YNL203C (YNL203C)
MBS7039868-01 0.02 mg

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YNL203C (YNL203C)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YNL203C (YNL203C)
MBS7039868-02 0.1 mg

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YNL203C (YNL203C)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YNL203C (YNL203C)
MBS7039868-03 5x 0.1 mg

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YNL203C (YNL203C)

Sign In for Pricing
View Details
LIN28A Antibody
orb415037-01 50 µg

LIN28A Antibody

Sign In for Pricing
View Details
LIN28A Antibody
orb415037-02 100 µg

LIN28A Antibody

Sign In for Pricing
View Details