Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lynx1 Rabbit Polyclonal Antibody (HRP)

Lynx1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SLURP-2, AI838844

UniProt

Q9WVC2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PAMATYCMTTRTYFTPYRMKVRKSCVPSCFETVYDGYSKHASATSCCQYY

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

13kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_035968

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGD1564854 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6038603 1.0 µg DNA

RGD1564854 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
UGT1A10 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2584208 1.0 µg DNA

UGT1A10 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
CHAT Polyclonal Antibody
MBS2556052-01 0.06 mL

CHAT Polyclonal Antibody

Sign In for Pricing
View Details
CHAT Polyclonal Antibody
MBS2556052-02 0.12 mL

CHAT Polyclonal Antibody

Sign In for Pricing
View Details
CHAT Polyclonal Antibody
MBS2556052-03 0.2 mL

CHAT Polyclonal Antibody

Sign In for Pricing
View Details
CHAT Polyclonal Antibody
MBS2556052-04 5x 0.2 mL

CHAT Polyclonal Antibody

Sign In for Pricing
View Details