Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RP11-217H1.1 Rabbit Polyclonal Antibody (Biotin)

RP11-217H1.1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

IAP, XMEN, MRX95, OST3B, CDG1CC, PRO0756, SLC58A1, bA217H1.1

UniProt

B4DH58

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RP11-217H1.1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ARWRFWCVSVTMVVALLIVCDVPSASAQRKKEMVLSEKVSQLMEWTNKRP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_115497

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zinc-Copper Couple
TRC-Z439000-1G 1 g

Zinc-Copper Couple

Sign In for Pricing
View Details
Rpl28 (NM_009081) Mouse Tagged ORF Clone
MG200851 10 µg

Rpl28 (NM_009081) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Superoxide Dismutase 1 (SOD1) (NM_000454) Human Recombinant Protein
TP720521L 500 µg

Superoxide Dismutase 1 (SOD1) (NM_000454) Human Recombinant Protein

Sign In for Pricing
View Details
Protein Tyrosine Phosphatase-1B (PTP-1B) Activity Colorimetric Assay Kit
E-BC-K823-M 96 T (40 samples)

Protein Tyrosine Phosphatase-1B (PTP-1B) Activity Colorimetric Assay Kit

Sign In for Pricing
View Details
Human Maltase Glucoamylase, Intestinal (MGA) ELISA Kit
RD-MGA-Hu-01 96 Tests

Human Maltase Glucoamylase, Intestinal (MGA) ELISA Kit

Sign In for Pricing
View Details
Human Maltase Glucoamylase, Intestinal (MGA) ELISA Kit
RD-MGA-Hu-02 48 Tests

Human Maltase Glucoamylase, Intestinal (MGA) ELISA Kit

Sign In for Pricing
View Details