Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TPD52L3 Rabbit Polyclonal Antibody (HRP)

TPD52L3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

D55, hD55, TPD55, NYDSP25

UniProt

Q96J77

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TPD52L3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GLRQNLSKSWLDVQVSNTYVKQKTSAALSTMGTLICRKLGGVKKSATLRS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

15kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_001001874

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Lung
CS710616 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Mouse N-myc Downstream Regulated Gene 2 (NDRG2) ELISA Kit
RDR-NDRG2-Mu-01 96 Tests

Mouse N-myc Downstream Regulated Gene 2 (NDRG2) ELISA Kit

Sign In for Pricing
View Details
Mouse N-myc Downstream Regulated Gene 2 (NDRG2) ELISA Kit
RDR-NDRG2-Mu-02 48 Tests

Mouse N-myc Downstream Regulated Gene 2 (NDRG2) ELISA Kit

Sign In for Pricing
View Details
Tbc1d30 Mouse Gene Knockout Kit (CRISPR)
KN517253 1 Kit

Tbc1d30 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
REEP5 (NM_005669) Human Recombinant Protein
TP322224L 1 mg

REEP5 (NM_005669) Human Recombinant Protein

Sign In for Pricing
View Details
PTCH1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H8]
TA803788BM 100 µL

PTCH1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H8]

Sign In for Pricing
View Details