Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DPPA5 Rabbit Polyclonal Antibody (Biotin)

DPPA5 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ESG1

UniProt

A6NC42

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human DPPA5

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MGTLPARRHIPPWVKVPEDLKDPEVFQVQTRLLKAIFGPDGSRIPYIEQV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

13kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001020461

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATF4 (Activating Transcription Factor 4 (tax-Responsive Enhancer Element B67), CREB-2, CREB2, TAXREB67, TXREB) (AP) discontinued
243580-AP 100 µL

ATF4 (Activating Transcription Factor 4 (tax-Responsive Enhancer Element B67), CREB-2, CREB2, TAXREB67, TXREB) (AP) discontinued

Sign In for Pricing
View Details
Human Tetratricopeptide repeat protein 29, TTC29 ELISA Kit
MBS9323622-01 48 Well

Human Tetratricopeptide repeat protein 29, TTC29 ELISA Kit

Sign In for Pricing
View Details
Human Tetratricopeptide repeat protein 29, TTC29 ELISA Kit
MBS9323622-02 96 Well

Human Tetratricopeptide repeat protein 29, TTC29 ELISA Kit

Sign In for Pricing
View Details
Human Tetratricopeptide repeat protein 29, TTC29 ELISA Kit
MBS9323622-03 5x 96 Well

Human Tetratricopeptide repeat protein 29, TTC29 ELISA Kit

Sign In for Pricing
View Details
Human Tetratricopeptide repeat protein 29, TTC29 ELISA Kit
MBS9323622-04 10x 96 Well

Human Tetratricopeptide repeat protein 29, TTC29 ELISA Kit

Sign In for Pricing
View Details
Rabbit Anti Human VIL1 Monoclonal Clone AFGO-22 100ug
IRBAHUVIL1AFGO22C100ug 100 µg

Rabbit Anti Human VIL1 Monoclonal Clone AFGO-22 100ug

Sign In for Pricing
View Details