Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DPPA5 Rabbit Polyclonal Antibody (HRP)

DPPA5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ESG1

UniProt

A6NC42

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human DPPA5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MGTLPARRHIPPWVKVPEDLKDPEVFQVQTRLLKAIFGPDGSRIPYIEQV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

13kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001020461

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-zcrb1 antibody
SL18567R-01 50 µL

Rabbit Anti-zcrb1 antibody

Sign In for Pricing
View Details
Rabbit Anti-zcrb1 antibody
SL18567R-02 100 µL

Rabbit Anti-zcrb1 antibody

Sign In for Pricing
View Details
BC030500 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
13120154 3x 1.0 µg DNA

BC030500 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
NDRG4, ID (NDRG4, BDM1, KIAA1180, Protein NDRG4, Brain development-related molecule 1, N-myc downstream-regulated gene 4 protein, Vascular smooth muscle cell-associated protein 8) (Azide free) (HRP)
MBS6324280-01 0.2 mL

NDRG4, ID (NDRG4, BDM1, KIAA1180, Protein NDRG4, Brain development-related molecule 1, N-myc downstream-regulated gene 4 protein, Vascular smooth muscle cell-associated protein 8) (Azide free) (HRP)

Sign In for Pricing
View Details
NDRG4, ID (NDRG4, BDM1, KIAA1180, Protein NDRG4, Brain development-related molecule 1, N-myc downstream-regulated gene 4 protein, Vascular smooth muscle cell-associated protein 8) (Azide free) (HRP)
MBS6324280-02 5x 0.2 mL

NDRG4, ID (NDRG4, BDM1, KIAA1180, Protein NDRG4, Brain development-related molecule 1, N-myc downstream-regulated gene 4 protein, Vascular smooth muscle cell-associated protein 8) (Azide free) (HRP)

Sign In for Pricing
View Details
Goat anti-APOA1BP Antibody
dAP-1512 50 µg

Goat anti-APOA1BP Antibody

Sign In for Pricing
View Details