Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NRDC Rabbit Polyclonal Antibody (HRP)

NRDC Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NRD1, hNRD1, hNRD2

UniProt

O43847

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human NRD1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GSKMLSVHVVGYGKYELEEDGTPSSEDSNSSCEVMQLTYLPTSPLLADCI

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

132kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_001095132

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zebrafish ALCAMA Rabbit Polyclonal Antibody (HRP)
orb2818544 100 µg

Zebrafish ALCAMA Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Guinea pig 5-Hydroxyindoleacetic Acid ELISA Kit
MBS750609-01 48 Well

Guinea pig 5-Hydroxyindoleacetic Acid ELISA Kit

Sign In for Pricing
View Details
Guinea pig 5-Hydroxyindoleacetic Acid ELISA Kit
MBS750609-02 96 Well

Guinea pig 5-Hydroxyindoleacetic Acid ELISA Kit

Sign In for Pricing
View Details
Guinea pig 5-Hydroxyindoleacetic Acid ELISA Kit
MBS750609-03 5x 96 Well

Guinea pig 5-Hydroxyindoleacetic Acid ELISA Kit

Sign In for Pricing
View Details
Guinea pig 5-Hydroxyindoleacetic Acid ELISA Kit
MBS750609-04 10x 96 Well

Guinea pig 5-Hydroxyindoleacetic Acid ELISA Kit

Sign In for Pricing
View Details
Polyclonal Antibody to Coiled Coil Domain Containing Protein 80 (CCDC80)
TRV-0036576-01 20 µL

Polyclonal Antibody to Coiled Coil Domain Containing Protein 80 (CCDC80)

Sign In for Pricing
View Details