Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SHB Rabbit Polyclonal Antibody (HRP)

SHB Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BA3J10.2

UniProt

Q15464

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SHB

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ERPSQPPQAVPQASSAASASCGPATASCFSASSGSLPDDSGSTSDLIRAY

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_003019

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TDO (TPH2, TRPO, TDO2, Typtophan 2,3-dioxygenase, Tryptophanase, Typtophan Oxygenase, Tryptophan Pyrrolase, TO) (HRP)
134312-HRP 100 µL

TDO (TPH2, TRPO, TDO2, Typtophan 2,3-dioxygenase, Tryptophanase, Typtophan Oxygenase, Tryptophan Pyrrolase, TO) (HRP)

Sign In for Pricing
View Details
Used for the differentiation of microorganisms on the basis of dextrose, lactose and sucrose fermentation and hydrogen sulfide production.
MIMEB1829FA 40 Pieces/Case:40 Pieces/ PACKS:1 PACKS/CASE

Used for the differentiation of microorganisms on the basis of dextrose, lactose and sucrose fermentation and hydrogen sulfide production.

Sign In for Pricing
View Details
Human RAB38 protein
orb754805-01 50 µg

Human RAB38 protein

Sign In for Pricing
View Details
Human RAB38 protein
orb754805-02 100 µg

Human RAB38 protein

Sign In for Pricing
View Details
Human RAB38 protein
orb754805-03 200 µg

Human RAB38 protein

Sign In for Pricing
View Details
Human RAB38 protein
orb754805-04 1 mg

Human RAB38 protein

Sign In for Pricing
View Details