Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLIT3 Rabbit Polyclonal Antibody (FITC)

SLIT3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MEGF5, SLIL2, SLIT1, slit2, Slit-3

UniProt

O75094

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SLIT3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PRRLANKRISQIKSKKFRCSGSEDYRSRFSSECFMDLVCPEKCRCEGTIV

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

168kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_003053

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hamster Heat Shock 70Kda Protein 1 Like Protein ELISA Kit
MBS021875-01 48 Well

Hamster Heat Shock 70Kda Protein 1 Like Protein ELISA Kit

Sign In for Pricing
View Details
Hamster Heat Shock 70Kda Protein 1 Like Protein ELISA Kit
MBS021875-02 96 Well

Hamster Heat Shock 70Kda Protein 1 Like Protein ELISA Kit

Sign In for Pricing
View Details
Hamster Heat Shock 70Kda Protein 1 Like Protein ELISA Kit
MBS021875-03 5x 96 Well

Hamster Heat Shock 70Kda Protein 1 Like Protein ELISA Kit

Sign In for Pricing
View Details
Hamster Heat Shock 70Kda Protein 1 Like Protein ELISA Kit
MBS021875-04 10x 96 Well

Hamster Heat Shock 70Kda Protein 1 Like Protein ELISA Kit

Sign In for Pricing
View Details
GHR (Growth Hormone Receptor, GHBP, Somatotropin receptor, Growth hormone-binding protein, Serum-binding protein)
363287 200 µL

GHR (Growth Hormone Receptor, GHBP, Somatotropin receptor, Growth hormone-binding protein, Serum-binding protein)

Sign In for Pricing
View Details
EFHD1 Human Over-expression Lysate
orb1356314 100 µg

EFHD1 Human Over-expression Lysate

Sign In for Pricing
View Details