Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLIT3 Rabbit Polyclonal Antibody (HRP)

SLIT3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MEGF5, SLIL2, SLIT1, slit2, Slit-3

UniProt

O75094

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SLIT3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PRRLANKRISQIKSKKFRCSGSEDYRSRFSSECFMDLVCPEKCRCEGTIV

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

168kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_003053

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CAPN9, NT (Calpain-9, Digestive Tract-specific Calpain, New Calpain 4, nCL-4, Protein CG36, NCL4) (MaxLight 550)
MBS6466840-01 0.1 mL

CAPN9, NT (Calpain-9, Digestive Tract-specific Calpain, New Calpain 4, nCL-4, Protein CG36, NCL4) (MaxLight 550)

Sign In for Pricing
View Details
CAPN9, NT (Calpain-9, Digestive Tract-specific Calpain, New Calpain 4, nCL-4, Protein CG36, NCL4) (MaxLight 550)
MBS6466840-02 5x 0.1 mL

CAPN9, NT (Calpain-9, Digestive Tract-specific Calpain, New Calpain 4, nCL-4, Protein CG36, NCL4) (MaxLight 550)

Sign In for Pricing
View Details
Human Interleukin 7 Receptor (IL7R) ELISA Kit
EKL58387 96 Tests

Human Interleukin 7 Receptor (IL7R) ELISA Kit

Sign In for Pricing
View Details
ENO1P4 3'UTR Luciferase Stable Cell Line
TU006900 1.0 mL

ENO1P4 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Mouse Cdkn2c Pre-designed siRNA Set A
SI102294A 1 Each

Mouse Cdkn2c Pre-designed siRNA Set A

Sign In for Pricing
View Details
Mouse Monoclonal Enolase 1 Antibody (1G7) [DyLight 594]
NBP2-59457DL594 0.1 mL

Mouse Monoclonal Enolase 1 Antibody (1G7) [DyLight 594]

Sign In for Pricing
View Details