Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRT75 Rabbit Polyclonal Antibody (FITC)

KRT75 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

K75, PFB, K6HF, KB18, CK-75, hK6hf

UniProt

O95678

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human KRT75

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SFTTSGGHSLGAGLGGSGFSATSNRGLGGSGSSVKFVSTTSSSQKSYTH

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_004684

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ttc36 (NM_138951) Mouse Tagged ORF Clone
MG201732 10 µg

Ttc36 (NM_138951) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
CAMPS-Sp, triethylammonium salt 2mg
A16060-2 2 mg

CAMPS-Sp, triethylammonium salt 2mg

Sign In for Pricing
View Details
TMEM166 antibody
70R-9643 100 µL

TMEM166 antibody

Sign In for Pricing
View Details
PARD6G Human shRNA Plasmid Kit (Locus ID 84552)
TL302676 1 Kit

PARD6G Human shRNA Plasmid Kit (Locus ID 84552)

Sign In for Pricing
View Details
PAGE1 (P Antigen Family Member 1, PAGE-1, AL5, G Antigen 9, GAGE-9, G Antigen Family B Member 1, Prostate-associated Gene 1 Protein, GAGE9, GAGEB1, CT16.3) (PE)
MBS6401581-01 0.1 mL

PAGE1 (P Antigen Family Member 1, PAGE-1, AL5, G Antigen 9, GAGE-9, G Antigen Family B Member 1, Prostate-associated Gene 1 Protein, GAGE9, GAGEB1, CT16.3) (PE)

Sign In for Pricing
View Details
PAGE1 (P Antigen Family Member 1, PAGE-1, AL5, G Antigen 9, GAGE-9, G Antigen Family B Member 1, Prostate-associated Gene 1 Protein, GAGE9, GAGEB1, CT16.3) (PE)
MBS6401581-02 5x 0.1 mL

PAGE1 (P Antigen Family Member 1, PAGE-1, AL5, G Antigen 9, GAGE-9, G Antigen Family B Member 1, Prostate-associated Gene 1 Protein, GAGE9, GAGEB1, CT16.3) (PE)

Sign In for Pricing
View Details