Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRT75 Rabbit Polyclonal Antibody (HRP)

KRT75 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

K75, PFB, K6HF, KB18, CK-75, hK6hf

UniProt

O95678

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human KRT75

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SFTTSGGHSLGAGLGGSGFSATSNRGLGGSGSSVKFVSTTSSSQKSYTH

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_004684

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-TrkB/NTRK2 Antibody Picoband® Cy3 Conjugated
A01388-4-Cy3 100 µg/Vial

Anti-TrkB/NTRK2 Antibody Picoband® Cy3 Conjugated

Sign In for Pricing
View Details
100 µL Syringe
MLCP-100muSYR-1 1 Syringe

100 µL Syringe

Sign In for Pricing
View Details
CD45 (Leukocyte Common Antigen, LCA, Ly-5 T200) (AP)
MBS6260135-01 0.1 mL

CD45 (Leukocyte Common Antigen, LCA, Ly-5 T200) (AP)

Sign In for Pricing
View Details
CD45 (Leukocyte Common Antigen, LCA, Ly-5 T200) (AP)
MBS6260135-02 5x 0.1 mL

CD45 (Leukocyte Common Antigen, LCA, Ly-5 T200) (AP)

Sign In for Pricing
View Details
E2F7 Knockout HAP1 Polyclonal Cells
ARG40263 1 Million

E2F7 Knockout HAP1 Polyclonal Cells

Sign In for Pricing
View Details
CXCR4 Rabbit Polyclonal Antibody (Biotin)
orb2575473 100 µg

CXCR4 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details