Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDCD7 Rabbit Polyclonal Antibody (HRP)

PDCD7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

59K, ES18, HES18

UniProt

Q8N8D1

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PDCD7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YLQAEHSLPALIQIRHDWDQYLVPSDHPKGNFVPQGWVLPPLPSNDIWAT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_005698

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Escherichia coli (strain 8739/DSM 1576/Crooks) rpsS Polyclonal Antibody
MBS7184300 Inquire

Rabbit anti-Escherichia coli (strain 8739/DSM 1576/Crooks) rpsS Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal L3MBTL2 Antibody [CoraFluor 1]
NBP3-06352CL1 0.1 mL

Rabbit Polyclonal L3MBTL2 Antibody [CoraFluor 1]

Sign In for Pricing
View Details
PRAS40 T246 Rabbit Polyclonal Antibody
E53P05624 100 µL

PRAS40 T246 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Conjugated RAVER2 Rabbit mAb
C57091 100 µL

Conjugated RAVER2 Rabbit mAb

Sign In for Pricing
View Details
PLGA-PEG-MAL (20kDA-5.0kDA, LA:GA ratio 50:50)
TCL-00457-01 10 mg

PLGA-PEG-MAL (20kDA-5.0kDA, LA:GA ratio 50:50)

Sign In for Pricing
View Details
PLGA-PEG-MAL (20kDA-5.0kDA, LA:GA ratio 50:50)
TCL-00457-02 5 mg

PLGA-PEG-MAL (20kDA-5.0kDA, LA:GA ratio 50:50)

Sign In for Pricing
View Details