Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIPA1 Rabbit Polyclonal Antibody (HRP)

SIPA1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SPA1

UniProt

Q96FS4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SIPA1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TAKPSVPSADSETPLTQDRPGSPSGSEDKGNPAPELRASFLPRTLSLRNS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

112kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_006738

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GAD1 (Glutamate Decarboxylase 1, 67kD Glutamic Acid Decarboxylase, GAD-67, Glutamate Decarboxylase 67kD Isoform, GAD, GAD67) (MaxLight 490)
MBS6379181-01 0.1 mL

GAD1 (Glutamate Decarboxylase 1, 67kD Glutamic Acid Decarboxylase, GAD-67, Glutamate Decarboxylase 67kD Isoform, GAD, GAD67) (MaxLight 490)

Sign In for Pricing
View Details
GAD1 (Glutamate Decarboxylase 1, 67kD Glutamic Acid Decarboxylase, GAD-67, Glutamate Decarboxylase 67kD Isoform, GAD, GAD67) (MaxLight 490)
MBS6379181-02 5x 0.1 mL

GAD1 (Glutamate Decarboxylase 1, 67kD Glutamic Acid Decarboxylase, GAD-67, Glutamate Decarboxylase 67kD Isoform, GAD, GAD67) (MaxLight 490)

Sign In for Pricing
View Details
SF3B4 Polyclonal Antibody
E917608 100 µL

SF3B4 Polyclonal Antibody

Sign In for Pricing
View Details
PKD1P5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1655908 1.0 µg DNA

PKD1P5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Recombinant Clostridium Botulinum csrA Protein (aa 1-72) (strain 657 / Type Ba4)
VAng-Lsx8149-50gEcoli 50 µg (E. coli)

Recombinant Clostridium Botulinum csrA Protein (aa 1-72) (strain 657 / Type Ba4)

Sign In for Pricing
View Details
TMEM219 Protein (N-Human Fc Tag, )
P512371 100 µg

TMEM219 Protein (N-Human Fc Tag, )

Sign In for Pricing
View Details