Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF2C4 Rabbit Polyclonal Antibody (HRP)

EIF2C4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

EIF2C4

UniProt

Q9HCK5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human EIF2C4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DGHPSRYCATVRVQTSRQEISQELLYSQEVIQDLTNMVRELLIQFYKSTR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

95kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_060099

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsa-miR-7706 miRNA Antagomir
CIJ2504-01 10 nmol

Hsa-miR-7706 miRNA Antagomir

Sign In for Pricing
View Details
Hsa-miR-7706 miRNA Antagomir
CIJ2504-02 20 nmol

Hsa-miR-7706 miRNA Antagomir

Sign In for Pricing
View Details
ARPC1A, ID (Actin-related Protein 2/3 Complex Subunit 1A, SOP2-like Protein, SOP2L) (AP)
MBS6464077-01 0.2 mL

ARPC1A, ID (Actin-related Protein 2/3 Complex Subunit 1A, SOP2-like Protein, SOP2L) (AP)

Sign In for Pricing
View Details
ARPC1A, ID (Actin-related Protein 2/3 Complex Subunit 1A, SOP2-like Protein, SOP2L) (AP)
MBS6464077-02 5x 0.2 mL

ARPC1A, ID (Actin-related Protein 2/3 Complex Subunit 1A, SOP2-like Protein, SOP2L) (AP)

Sign In for Pricing
View Details
RASSF5 (Ras Association (RalGDS/AF-6) Domain Family Member 5, MGC10823, MGC17344, Maxp1, NORE1, NORE1A, NORE1B, RAPL, RASSF3) (MaxLight 650)
250910-ML650 100 µL

RASSF5 (Ras Association (RalGDS/AF-6) Domain Family Member 5, MGC10823, MGC17344, Maxp1, NORE1, NORE1A, NORE1B, RAPL, RASSF3) (MaxLight 650)

Sign In for Pricing
View Details
Human Matrix metalloproteinase-14 ELISA Kit
MBS760251-01 48 Well

Human Matrix metalloproteinase-14 ELISA Kit

Sign In for Pricing
View Details