Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRKRIP1 Rabbit Polyclonal Antibody (HRP)

PRKRIP1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C114, KRBOX3

UniProt

Q9H875

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PRKRIP1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MASPAASSVRPPRPKKEPQTLVIPKNAAEEQKLKLERLMKNPDKAVPIPE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_078929

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Ucp3 shRNA (UAS) - Lentiviral mouse Ucp3 shRNA (UAS, RFP) plasmid
GTR15272929 1 Vial

Lentiviral mouse Ucp3 shRNA (UAS) - Lentiviral mouse Ucp3 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
AADACL4 antibody
70R-6671 100 µL

AADACL4 antibody

Sign In for Pricing
View Details
HDLBP Protein Vector (Rat) (pPB-N-His)
PV272511 500 ng

HDLBP Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Yy2 ORF Vector (Mouse) (pORF)
ORF062044 1.0 µg DNA

Yy2 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Pipette tips racked TipRack 2-200 ul BIO-CERT PP IVD colorless
PIP4736 960 / PCK

Pipette tips racked TipRack 2-200 ul BIO-CERT PP IVD colorless

Sign In for Pricing
View Details
RNF86 Antibody
orb1324422 100 µL

RNF86 Antibody

Sign In for Pricing
View Details