Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Eif2c3 Rabbit Polyclonal Antibody (FITC)

Eif2c3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

EIF2C, Eif2c3, AW048688, C130014L07Rik

UniProt

Q8CJF9

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VHAVDVVLRHLPSMKYTPVGRSFFSAPEGYDHPLGGGREVWFGFHQSVRP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

97kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_700451

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cavy Thyroid Hormone Receptor Alpha ELISA Kit
MBS068107 Inquire

Cavy Thyroid Hormone Receptor Alpha ELISA Kit

Sign In for Pricing
View Details
MES-NaCl-EDTA Buffer, pH 6.5
41320099-3 500 mL

MES-NaCl-EDTA Buffer, pH 6.5

Sign In for Pricing
View Details
Porcine Fibronectin Type III Domain Containing Protein 5 (FNDC5) ELISA Kit
MBS2615841-01 48 Well

Porcine Fibronectin Type III Domain Containing Protein 5 (FNDC5) ELISA Kit

Sign In for Pricing
View Details
Porcine Fibronectin Type III Domain Containing Protein 5 (FNDC5) ELISA Kit
MBS2615841-02 96 Well

Porcine Fibronectin Type III Domain Containing Protein 5 (FNDC5) ELISA Kit

Sign In for Pricing
View Details
Porcine Fibronectin Type III Domain Containing Protein 5 (FNDC5) ELISA Kit
MBS2615841-03 5x 96 Well

Porcine Fibronectin Type III Domain Containing Protein 5 (FNDC5) ELISA Kit

Sign In for Pricing
View Details
Porcine Fibronectin Type III Domain Containing Protein 5 (FNDC5) ELISA Kit
MBS2615841-04 10x 96 Well

Porcine Fibronectin Type III Domain Containing Protein 5 (FNDC5) ELISA Kit

Sign In for Pricing
View Details