Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LZTS2 Rabbit Polyclonal Antibody (HRP)

LZTS2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LAPSER1

UniProt

Q9BRK4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human LZTS2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EPLCPAVPPRKAVPVTSFTYINEDFRTESPPSPSSDVEDAREQRAHNAHL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

73kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_115805

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal VASP Antibody [Alexa Fluor 647]
NBP2-41363AF647 0.1 mL

Rabbit Polyclonal VASP Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
Bovine Glial Cell Derived Neurotrophic Factor (GDNF) ELISA Kit-Sandwich
EK10F314-01 48 Test

Bovine Glial Cell Derived Neurotrophic Factor (GDNF) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Bovine Glial Cell Derived Neurotrophic Factor (GDNF) ELISA Kit-Sandwich
EK10F314-02 96 Tests

Bovine Glial Cell Derived Neurotrophic Factor (GDNF) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Nbr1 (NM_001024765) Rat Tagged ORF Clone Lentiviral Particle
RR205320L4V 200 µL

Nbr1 (NM_001024765) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Hcfc1 Mouse shRNA Plasmid (Locus ID 15161)
TL500936 1 Kit

Hcfc1 Mouse shRNA Plasmid (Locus ID 15161)

Sign In for Pricing
View Details
Cdk2 ORF Vector (Mouse) (pORF)
15696015 1.0 µg DNA

Cdk2 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details