Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RASGRP2 Rabbit Polyclonal Antibody (HRP)

RASGRP2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CDC25L, CALDAG-GEFI

UniProt

Q7LDG7

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RASGRP2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LVRMFLMMHPWYIPSSQLAAKLLHIYQQSRKDNSNSLQVKTCHLVRYWIS

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

69kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_722541

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LKB1 Rabbit Polyclonal Antibody (Cy7)
orb1046195 100 µL

LKB1 Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
S6K1 (RPS6KB1) (NM_003161) Human Over-expression Lysate
E45H19273-2 20 µg

S6K1 (RPS6KB1) (NM_003161) Human Over-expression Lysate

Sign In for Pricing
View Details
P5F1B, CT (POU5F1B, OTF3C, OTF3P1, POU5F1P1, POU5FLC20, POU5FLC8, Putative POU domain, class 5, transcription factor 1B, Octamer-binding protein 3-like, Octamer-binding transcription factor 3-like) (Azide free) (HRP)
MBS6330322-01 0.2 mL

P5F1B, CT (POU5F1B, OTF3C, OTF3P1, POU5F1P1, POU5FLC20, POU5FLC8, Putative POU domain, class 5, transcription factor 1B, Octamer-binding protein 3-like, Octamer-binding transcription factor 3-like) (Azide free) (HRP)

Sign In for Pricing
View Details
P5F1B, CT (POU5F1B, OTF3C, OTF3P1, POU5F1P1, POU5FLC20, POU5FLC8, Putative POU domain, class 5, transcription factor 1B, Octamer-binding protein 3-like, Octamer-binding transcription factor 3-like) (Azide free) (HRP)
MBS6330322-02 5x 0.2 mL

P5F1B, CT (POU5F1B, OTF3C, OTF3P1, POU5F1P1, POU5FLC20, POU5FLC8, Putative POU domain, class 5, transcription factor 1B, Octamer-binding protein 3-like, Octamer-binding transcription factor 3-like) (Azide free) (HRP)

Sign In for Pricing
View Details
Seviteronel 25mg
A20996-25 25 mg

Seviteronel 25mg

Sign In for Pricing
View Details
HBP1 Antibody
E51A02403 100 µL

HBP1 Antibody

Sign In for Pricing
View Details