Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GNL3 Rabbit Polyclonal Antibody (Biotin)

GNL3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

NS, E2IG3, NNP47, C77032

UniProt

Q9BVP2

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human GNL3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MTCHKRYKIQKKVREHHRKLRKEAKKRGHKKPRKDPGVPNSAPFKEALLR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_996561

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Semaphorin 4A Alexa Fluor 594 Antibody (Clone 757129)
FAB8166T-100UG 100 µg

Mouse Semaphorin 4A Alexa Fluor 594 Antibody (Clone 757129)

Sign In for Pricing
View Details
1-Butyl-3-methylimidazolium bis (trifluoromethylsulfonyl) imide
IL-0029-UP-0500 500 g

1-Butyl-3-methylimidazolium bis (trifluoromethylsulfonyl) imide

Sign In for Pricing
View Details
IL-13, Human (CHO-expressed)
Z03020-50 50 µg

IL-13, Human (CHO-expressed)

Sign In for Pricing
View Details
Srrm1 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4509002 1.0 µg DNA

Srrm1 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Olfr11 Double Nickase Plasmid (m)
sc-432275-NIC 20 µg

Olfr11 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
Mouse Transient Receptor Potential Cation Channel Subfamily M, Member 6 (TRPM6) ELISA Kit
DLR-TRPM6-Mu-01 48 Tests

Mouse Transient Receptor Potential Cation Channel Subfamily M, Member 6 (TRPM6) ELISA Kit

Sign In for Pricing
View Details