Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GNL3 Rabbit Polyclonal Antibody (FITC)

GNL3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

NS, E2IG3, NNP47, C77032

UniProt

Q9BVP2

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human GNL3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MTCHKRYKIQKKVREHHRKLRKEAKKRGHKKPRKDPGVPNSAPFKEALLR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_996561

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CD74 Antibody (CLIP/1133) [Alexa Fluor 532]
NBP3-11486AF532 0.1 mL

Mouse Monoclonal CD74 Antibody (CLIP/1133) [Alexa Fluor 532]

Sign In for Pricing
View Details
Mouse Monoclonal VEGF Antibody (VG1) [DyLight 405]
FAB2932E 0.1 mL

Mouse Monoclonal VEGF Antibody (VG1) [DyLight 405]

Sign In for Pricing
View Details
FRA2 Rabbit Monoclonal Antibody
orb866488 100 µL

FRA2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
BID, CT (BH3-interacting Domain Death Agonist, BH3-interacting Domain Death Agonist p11, p11 BID, BH3 interacting domain death agonist p13, p13 BID, BH3 interacting domain death agonist p15, p15 BID, BID Isoform L (2), Apoptotic Death Agonist, Desmocollin Type 4, HGNC:1050, Human BID Coding Sequence, MGC15319, MGC42355, p22 BID) (MaxLight 405) discontinued
B1095-08-ML405 100 µL

BID, CT (BH3-interacting Domain Death Agonist, BH3-interacting Domain Death Agonist p11, p11 BID, BH3 interacting domain death agonist p13, p13 BID, BH3 interacting domain death agonist p15, p15 BID, BID Isoform L (2), Apoptotic Death Agonist, Desmocollin Type 4, HGNC:1050, Human BID Coding Sequence, MGC15319, MGC42355, p22 BID) (MaxLight 405) discontinued

Sign In for Pricing
View Details
ITGA2 Antibody
A18529-100UG 100 µg

ITGA2 Antibody

Sign In for Pricing
View Details
Anti-Leucine Rich Alpha-2-Glycoprotein 1 (LRG1) Polyclonal antibody
FY-AB37476-01 1 mL

Anti-Leucine Rich Alpha-2-Glycoprotein 1 (LRG1) Polyclonal antibody

Sign In for Pricing
View Details