Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Itgb1 Rabbit Polyclonal Antibody (HRP)

Itgb1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Fn, CD29, Fnrb, gpIIa, Gm9863, AA409975, AA960159, 4633401G24Rik

UniProt

P09055

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWD

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

86kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_034708

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Amino-2-[ (3-methylphenyl) methyl]propanoic acid hydrochloride
YGC02526-01 100 mg

3-Amino-2-[ (3-methylphenyl) methyl]propanoic acid hydrochloride

Sign In for Pricing
View Details
3-Amino-2-[ (3-methylphenyl) methyl]propanoic acid hydrochloride
YGC02526-02 1 g

3-Amino-2-[ (3-methylphenyl) methyl]propanoic acid hydrochloride

Sign In for Pricing
View Details
Cyclophilin A (PPIA) Human Gene Knockout Kit (CRISPR)
KN203307 1 Kit

Cyclophilin A (PPIA) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rabbit Polyclonal RIMS2 Antibody [Alexa Fluor 350]
NBP1-76905AF350 0.1 mL

Rabbit Polyclonal RIMS2 Antibody [Alexa Fluor 350]

Sign In for Pricing
View Details
Lentiviral mouse Smg1 shRNA (UAS) - Lentiviral mouse Smg1 shRNA (UAS, RFP) plasmid
GTR15238645 1 Vial

Lentiviral mouse Smg1 shRNA (UAS) - Lentiviral mouse Smg1 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
BCL6 Antibody
A40257-100UG 100 µg

BCL6 Antibody

Sign In for Pricing
View Details