Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hsp90ab1 Rabbit Polyclonal Antibody (HRP)

Hsp90ab1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Hsp, 90kDa, Hsp84, Hsp90, Hspcb, C81438, Hsp84-1, AL022974

UniProt

P11499

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NASDALDKIRYESLTDPSKLDSGKELKIDIIPNPQERTLTLVDTGIGMTK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

83kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_032328

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NMDAR1 (GRIN1) (NM_000832) Human Recombinant Protein
TP319368M 100 µg

NMDAR1 (GRIN1) (NM_000832) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant QSOX1 Antibody
RC-5887-01 50 μL

Recombinant QSOX1 Antibody

Sign In for Pricing
View Details
Recombinant QSOX1 Antibody
RC-5887-02 100 µL

Recombinant QSOX1 Antibody

Sign In for Pricing
View Details
Recombinant QSOX1 Antibody
RC-5887-03 1 mL

Recombinant QSOX1 Antibody

Sign In for Pricing
View Details
ODF3B (N-term) Rabbit Polyclonal Antibody
AP52990PU-N 400 µL

ODF3B (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human ACRBP activation kit by CRISPRa
GA113578 1 Kit

Human ACRBP activation kit by CRISPRa

Sign In for Pricing
View Details