Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

App Rabbit Polyclonal Antibody (Biotin)

App Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

A, C, Ag, Abe, bet, Abpp, Adap, Cvap, Abeta, betaApp, E030013M08Rik

UniProt

P12023

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human App

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQ

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

83kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001185753

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human ACTR1B shRNA (UAS) - Lentiviral human ACTR1B shRNA (UAS) plasmid
GTR15116431 1 Vial

Lentiviral human ACTR1B shRNA (UAS) - Lentiviral human ACTR1B shRNA (UAS) plasmid

Sign In for Pricing
View Details
Pim-1 kinase inhibitor 8
M37329-01 1 g

Pim-1 kinase inhibitor 8

Sign In for Pricing
View Details
Pim-1 kinase inhibitor 8
M37329-02 500 mg

Pim-1 kinase inhibitor 8

Sign In for Pricing
View Details
Pim-1 kinase inhibitor 8
M37329-03 5 mg

Pim-1 kinase inhibitor 8

Sign In for Pricing
View Details
Pim-1 kinase inhibitor 8
M37329-04 10 mg

Pim-1 kinase inhibitor 8

Sign In for Pricing
View Details
Pim-1 kinase inhibitor 8
M37329-05 25 mg

Pim-1 kinase inhibitor 8

Sign In for Pricing
View Details