Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

App Rabbit Polyclonal Antibody (HRP)

App Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

A, C, Ag, Abe, bet, Abpp, Adap, Cvap, Abeta, betaApp, E030013M08Rik

UniProt

P12023

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human App

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQ

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

83kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001185753

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GR antibody (Ser226)
70R-31292 0.1 mg

GR antibody (Ser226)

Sign In for Pricing
View Details
DERP2 Antibody
orb862223-01 50 μL

DERP2 Antibody

Sign In for Pricing
View Details
DERP2 Antibody
orb862223-02 100 µL

DERP2 Antibody

Sign In for Pricing
View Details
Kidney Tumor Tissue Array - 12 cases of kidney cancer paired with adjacent normal tissues
Z7020053 5 Slides

Kidney Tumor Tissue Array - 12 cases of kidney cancer paired with adjacent normal tissues

Sign In for Pricing
View Details
C2CD6 Human Over-expression Lysate
orb1359395 20 µg

C2CD6 Human Over-expression Lysate

Sign In for Pricing
View Details
Anti-Monkeypox virus/MPXV B2R/HA/Hemagglutinin Polyclonal Antibody
PTX18846-01 50 µg

Anti-Monkeypox virus/MPXV B2R/HA/Hemagglutinin Polyclonal Antibody

Sign In for Pricing
View Details