Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Arsb Rabbit Polyclonal Antibody (Biotin)

Arsb Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

A, As, As-, As1, Ast, As-1, As-1r, As-1s, As-1t, As1-r, As1-s, As1-t, Asr-1, Ast-1, AI480648, 1110007C02Rik

UniProt

P50429

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TDNGGQTRSGGNNWPLRGRKGTLWEGGIRGTGFVASPLLKQKGVKSRELM

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_033842

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 8 (TS1), 0.2mg/mL
BNUB0627-100 1x 100 µL

Cytokeratin 8 (TS1), 0.2mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS518016 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
PD L2 (PDCD1LG2) Mouse Monoclonal Antibody [Clone ID: OTI5E5]
CF808977 100 µg

PD L2 (PDCD1LG2) Mouse Monoclonal Antibody [Clone ID: OTI5E5]

Sign In for Pricing
View Details
BCMA Recombinant Rabbit monoclonal Antibody
HA723959 100 µL

BCMA Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Serum Response Factor (SRF) Rabbit Polyclonal Antibody
AP06324PU-N 100 µg

Serum Response Factor (SRF) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ATP6V1B1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3B11]
TA502550BM 100 µL

ATP6V1B1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3B11]

Sign In for Pricing
View Details