Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bax Rabbit Polyclonal Antibody (FITC)

Bax Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

G3V8T9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Rat Bax

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PQDASTKKLSECLRRIGDELDNNMELQRMIADVDTDSPREVFFRVAADMF

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_058755

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFluor® 488 Anti-human CD34 Antibody *4H11*
10340051-AAT 500 Tests

IFluor® 488 Anti-human CD34 Antibody *4H11*

Sign In for Pricing
View Details
Hsa-miR-651-5p miRNA Agomir
CMJ0427-01 5 nmol

Hsa-miR-651-5p miRNA Agomir

Sign In for Pricing
View Details
Hsa-miR-651-5p miRNA Agomir
CMJ0427-02 10 nmol

Hsa-miR-651-5p miRNA Agomir

Sign In for Pricing
View Details
Hsa-miR-651-5p miRNA Agomir
CMJ0427-03 20 nmol

Hsa-miR-651-5p miRNA Agomir

Sign In for Pricing
View Details
ACTG1, ID (Actin, Cytoplasmic 2, Gamma-actin, Actin, Cytoplasmic 2, N-terminally Processed, ACTG, ACTB) (MaxLight 750)
MBS6461211-01 0.1 mL

ACTG1, ID (Actin, Cytoplasmic 2, Gamma-actin, Actin, Cytoplasmic 2, N-terminally Processed, ACTG, ACTB) (MaxLight 750)

Sign In for Pricing
View Details
ACTG1, ID (Actin, Cytoplasmic 2, Gamma-actin, Actin, Cytoplasmic 2, N-terminally Processed, ACTG, ACTB) (MaxLight 750)
MBS6461211-02 5x 0.1 mL

ACTG1, ID (Actin, Cytoplasmic 2, Gamma-actin, Actin, Cytoplasmic 2, N-terminally Processed, ACTG, ACTB) (MaxLight 750)

Sign In for Pricing
View Details