Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BCL2 Rabbit Polyclonal Antibody (HRP)

BCL2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Bcl-2, PPP1R50

UniProt

P10415

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human BCL2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVV

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_000624

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SSX1 Recombinant Protein
PROTQ16384-10ug 10 µg

Human SSX1 Recombinant Protein

Sign In for Pricing
View Details
N-Acetyl L-Thyroxine Ethyl Ester
MBS6046675-01 10 mg

N-Acetyl L-Thyroxine Ethyl Ester

Sign In for Pricing
View Details
N-Acetyl L-Thyroxine Ethyl Ester
MBS6046675-02 5x 10 mg

N-Acetyl L-Thyroxine Ethyl Ester

Sign In for Pricing
View Details
CD91a (a2-Macroglobulin Receptor, a2MR) (MaxLight 490)
C2441-91-ML490 100 µL

CD91a (a2-Macroglobulin Receptor, a2MR) (MaxLight 490)

Sign In for Pricing
View Details
RGD1307752 (NM_001013922) Rat Untagged Clone
RN202376 10 µg

RGD1307752 (NM_001013922) Rat Untagged Clone

Sign In for Pricing
View Details
Rent1 (B-4) : m-IgG3 BP-HRP Bundle
sc-550473 1 Kit

Rent1 (B-4) : m-IgG3 BP-HRP Bundle

Sign In for Pricing
View Details