Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sh3glb1 Rabbit Polyclonal Antibody (FITC)

Sh3glb1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Bif-, Bif-1, AA409932, AI314629, AU015566, mKIAA0491

UniProt

Q9JK48

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KIMKQTEVLLQPNPNARIEEFVYEKLDRKAPSRINNPELLGQYMIDAGTE

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_062337

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Folr4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3162405 3x 1.0 µg

Folr4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Bzrap1 (BC066146) Mouse Tagged ORF Clone
MR203496 10 µg

Bzrap1 (BC066146) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Bovine N-terminal pro-brain natriuretic peptide ELISA Kit
GTR10424221 96 Well

Bovine N-terminal pro-brain natriuretic peptide ELISA Kit

Sign In for Pricing
View Details
PARD6A (m) -PR
sc-40810-PR 10 µM - 20 µL

PARD6A (m) -PR

Sign In for Pricing
View Details
Tbc1d12 ORF Vector (Mouse) (pORF)
46228014 1.0 µg DNA

Tbc1d12 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Vdac3 (NM_031355) Rat Tagged ORF Clone Lentiviral Particle
RR201585L3V 200 µL

Vdac3 (NM_031355) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details