Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sh3glb1 Rabbit Polyclonal Antibody (HRP)

Sh3glb1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Bif-, Bif-1, AA409932, AI314629, AU015566, mKIAA0491

UniProt

Q9JK48

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KIMKQTEVLLQPNPNARIEEFVYEKLDRKAPSRINNPELLGQYMIDAGTE

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_062337

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

METTL21A Antibody Blocking Peptide
orb1512106 500 µg

METTL21A Antibody Blocking Peptide

Sign In for Pricing
View Details
KDM1A Antibody
CSB-PA787915-01 50 μL

KDM1A Antibody

Sign In for Pricing
View Details
KDM1A Antibody
CSB-PA787915-02 100 µL

KDM1A Antibody

Sign In for Pricing
View Details
PRKACB Protein Vector (Mouse) (pPB-N-His)
PV219211 500 ng

PRKACB Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Recombinant Escherichia coli O9:H4 Adenine phosphoribosyltransferase (apt)
MBS1153661-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O9:H4 Adenine phosphoribosyltransferase (apt)

Sign In for Pricing
View Details
Recombinant Escherichia coli O9:H4 Adenine phosphoribosyltransferase (apt)
MBS1153661-02 0.1 mg (E-Coli)

Recombinant Escherichia coli O9:H4 Adenine phosphoribosyltransferase (apt)

Sign In for Pricing
View Details