Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bnip3l Rabbit Polyclonal Antibody (HRP)

Bnip3l Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

N, Nix, Nip3L, C86132, D14Ertd719, D14Ertd719e

UniProt

Q9Z2F7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CDSPSPQEDGQIMFDVEMHTSRDHSSQSEEEVVEGEKEVEALKKSADWVS

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_033891

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethyl 2-((1,3-Dioxoisoindolin-2-yl)oxy)acetate
TRC-E708300-2.5G 2.5 g

Ethyl 2-((1,3-Dioxoisoindolin-2-yl)oxy)acetate

Sign In for Pricing
View Details
FBXO44 (NM_183412) Human Over-expression Lysate
LC430665 20 µg

FBXO44 (NM_183412) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human β-Actin/Beta Actin Protein (His Tag)
PKSH033261-01 10 µg

Recombinant Human β-Actin/Beta Actin Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human β-Actin/Beta Actin Protein (His Tag)
PKSH033261-02 50 µg

Recombinant Human β-Actin/Beta Actin Protein (His Tag)

Sign In for Pricing
View Details
Human HINT2 activation kit by CRISPRa
GA113651 1 Kit

Human HINT2 activation kit by CRISPRa

Sign In for Pricing
View Details
CD28 (204.12), 0.2mg/mL
BNUB0164-500 1x 500 µL

CD28 (204.12), 0.2mg/mL

Sign In for Pricing
View Details