Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STK17A Rabbit Polyclonal Antibody (HRP)

STK17A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DRAK1

UniProt

Q9UEE5

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human STK17A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KSETKESIVTEELIVVTSYTLGQCRQSEKEKMEQKAISKRFKFEEPLLQE

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_004751

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD106 / VCAM1 (B-K9), CF568 conjugate, 0.1mg/mL
BNC680304-100 1x 100 µL

CD106 / VCAM1 (B-K9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX2 (Transcription Factor) (SOX2/1791), CF640R conjugate, 0.1mg/mL
BNC401791-100 1x 100 µL

SOX2 (Transcription Factor) (SOX2/1791), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (Endothelial Cell Marker), CF647 conjugate, 0.1mg/mL
BNC471662-100 1x 100 µL

CD31 / PECAM-1 (Endothelial Cell Marker), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Vmn2r45 Mouse Gene Knockout Kit (CRISPR)
KN519174 1 Kit

Vmn2r45 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
VEGF Receptor 2 (KDR) pTyr1175 Rabbit Polyclonal Antibody
AP02382PU-S 50 µL

VEGF Receptor 2 (KDR) pTyr1175 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TBXAS1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H9]
TA501357BM 100 µL

TBXAS1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H9]

Sign In for Pricing
View Details