Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF4E2 Rabbit Polyclonal Antibody (FITC)

EIF4E2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

4EHP, IF4e, 4E-LP, h4EHP, EIF4EL3

UniProt

O60573

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human EIF4E2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_004837

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RSHL1 (C-9) Alexa Fluor® 594
sc-398317 AF594 200 µg/mL

RSHL1 (C-9) Alexa Fluor® 594

Sign In for Pricing
View Details
Sheep Sodium Coupled Neutral Amino Acid Transporter 4 (SNAT4) ELISA Kit
YP-W74837-01 48 Tests

Sheep Sodium Coupled Neutral Amino Acid Transporter 4 (SNAT4) ELISA Kit

Sign In for Pricing
View Details
Sheep Sodium Coupled Neutral Amino Acid Transporter 4 (SNAT4) ELISA Kit
YP-W74837-02 96 Tests

Sheep Sodium Coupled Neutral Amino Acid Transporter 4 (SNAT4) ELISA Kit

Sign In for Pricing
View Details
ZDHHC16 Polyclonal Antibody, PE-Cy5 Conjugated
bs-7677R-PE-Cy5 100 µL

ZDHHC16 Polyclonal Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
Polyclonal antibody-Canine Interleukin-10
PA-RA-07870 100 µg

Polyclonal antibody-Canine Interleukin-10

Sign In for Pricing
View Details
MCAF1 (ATF7IP) (NM_018179) Human Tagged ORF Clone Lentiviral Particle
RC220292L3V 200 µL

MCAF1 (ATF7IP) (NM_018179) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details