Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DFFA, Human (GST)

DFFA Protein is a heterodimeric complex of nuclease CAD and its specific inhibitor ICAD. DFFA Protein, Human (GST) is a substrate for caspase-3 that triggers DNA breakage during apoptosis. DFFA Protein, Human (GST) is the recombinant human-derived DFFA protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

DFFA Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dffa-protein-human-gst.html

Smiles

MEVTGDAGVPESGEIRTLKPCLLRRNYSREQHGVAASCLEDLRSKACDILAIDKSLTPVTLVLAEDGTIVDDDDYFLCLPSNTKFVALASNEKWAYNNSDGGTAWISQESFDVDETDSGAGLKWKNVARQLKEDLSSIILLSEEDLQMLVDAPCSDLAQELRQSCATVQRLQHTLQQVLDQREEVRQSKQLLQLYLQALEKEGSLLSKQEESKAAFGEEVDAVDTGISRETSSDVALASHILTALREKQAPELSLSSQDLELVTKEDPKALAVALNWDIKKTETVQEACEWELALRLQQTQSLHSLRSISASKASPPGDLQNPKRARQDPT

Molecular Formula

1676 (Gene_ID) O00273 (M1-T331) (Accession)

Molecular Weight

63.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Sheep Tumor necrosis factor receptor superfamily member 10B ELISA Kit
MBS7273117-01 48 Well

Sheep Tumor necrosis factor receptor superfamily member 10B ELISA Kit

Ask
View Details
Sheep Tumor necrosis factor receptor superfamily member 10B ELISA Kit
MBS7273117-02 96 Well

Sheep Tumor necrosis factor receptor superfamily member 10B ELISA Kit

Ask
View Details
Sheep Tumor necrosis factor receptor superfamily member 10B ELISA Kit
MBS7273117-03 5x 96 Well

Sheep Tumor necrosis factor receptor superfamily member 10B ELISA Kit

Ask
View Details
Sheep Tumor necrosis factor receptor superfamily member 10B ELISA Kit
MBS7273117-04 10x 96 Well

Sheep Tumor necrosis factor receptor superfamily member 10B ELISA Kit

Ask
View Details
OR4K15 Recombinant Protein Antigen
NBP2-30939PEP 0.1 mL

OR4K15 Recombinant Protein Antigen

Ask
View Details
CCT6A (NM_001762) Human Tagged ORF Clone
RG217027 10 µg

CCT6A (NM_001762) Human Tagged ORF Clone

Ask
View Details