DFFA, Human (GST)
DFFA Protein is a heterodimeric complex of nuclease CAD and its specific inhibitor ICAD. DFFA Protein, Human (GST) is a substrate for caspase-3 that triggers DNA breakage during apoptosis. DFFA Protein, Human (GST) is the recombinant human-derived DFFA protein, expressed by E. coli , with N-GST labeled tag.
Product Specifications
Product Name Alternative
DFFA Protein, Human (GST), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/dffa-protein-human-gst.html
Smiles
MEVTGDAGVPESGEIRTLKPCLLRRNYSREQHGVAASCLEDLRSKACDILAIDKSLTPVTLVLAEDGTIVDDDDYFLCLPSNTKFVALASNEKWAYNNSDGGTAWISQESFDVDETDSGAGLKWKNVARQLKEDLSSIILLSEEDLQMLVDAPCSDLAQELRQSCATVQRLQHTLQQVLDQREEVRQSKQLLQLYLQALEKEGSLLSKQEESKAAFGEEVDAVDTGISRETSSDVALASHILTALREKQAPELSLSSQDLELVTKEDPKALAVALNWDIKKTETVQEACEWELALRLQQTQSLHSLRSISASKASPPGDLQNPKRARQDPT
Molecular Formula
1676 (Gene_ID) O00273 (M1-T331) (Accession)
Molecular Weight
63.6 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MLEL858-51 1 Kit
Gene Mutation Detection Kit for Moderately to poorly differentiated adenocarcinoma (E(L858R) Mutation)
Sign In for Pricing
View Details 
YP-W19668-01 48 Tests
Human aldo-keto reductase 1C3 (AKR1C3) ELISA Kit
Sign In for Pricing
View Details