Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF4E2 Rabbit Polyclonal Antibody (Biotin)

EIF4E2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

4EHP, IF4e, 4E-LP, h4EHP, EIF4EL3

UniProt

O60573

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human EIF4E2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: YTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004837

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep anti-deoxyribonuclease B antibody (anti-DNase B Ab) ELISA Kit
MBS7242766-01 48 Well

Sheep anti-deoxyribonuclease B antibody (anti-DNase B Ab) ELISA Kit

Sign In for Pricing
View Details
Sheep anti-deoxyribonuclease B antibody (anti-DNase B Ab) ELISA Kit
MBS7242766-02 96 Well

Sheep anti-deoxyribonuclease B antibody (anti-DNase B Ab) ELISA Kit

Sign In for Pricing
View Details
Sheep anti-deoxyribonuclease B antibody (anti-DNase B Ab) ELISA Kit
MBS7242766-03 5x 96 Well

Sheep anti-deoxyribonuclease B antibody (anti-DNase B Ab) ELISA Kit

Sign In for Pricing
View Details
Sheep anti-deoxyribonuclease B antibody (anti-DNase B Ab) ELISA Kit
MBS7242766-04 10x 96 Well

Sheep anti-deoxyribonuclease B antibody (anti-DNase B Ab) ELISA Kit

Sign In for Pricing
View Details
Polygalasaponin XXXI
HY-N2216-01 1 mg

Polygalasaponin XXXI

Sign In for Pricing
View Details
Polygalasaponin XXXI
HY-N2216-02 5 mg

Polygalasaponin XXXI

Sign In for Pricing
View Details