Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GNAI3 Rabbit Polyclonal Antibody (HRP)

GNAI3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

87U6, ARCND1

UniProt

P08754

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human GNAI3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ESGKSTIVKQMKIIHEDGYSEDECKQYKVVVYSNTIQSIIAIIRAMGRLK

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006487

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

11-Deoxy Corticosterone
TRC-D232590-10MG 10 mg

11-Deoxy Corticosterone

Sign In for Pricing
View Details
WNV TaqMan RT-PCR Kit Dx
DxTM44200 24 Reactions

WNV TaqMan RT-PCR Kit Dx

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 Nucleocapsid Protein, Biotinylated (His Tag)
PKSR030512 20 µg

Recombinant SARS-CoV-2 Nucleocapsid Protein, Biotinylated (His Tag)

Sign In for Pricing
View Details
Frozen Tissue Sections, Myometrium
CS501899 5x 5 µm

Frozen Tissue Sections, Myometrium

Sign In for Pricing
View Details
THEM4 (NM_053055) Human Over-expression Lysate
LY403283 100 µg

THEM4 (NM_053055) Human Over-expression Lysate

Sign In for Pricing
View Details
KCTD5 Human Gene Knockout Kit (CRISPR)
KN400180 1 Kit

KCTD5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details