Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GNAI3 Rabbit Polyclonal Antibody (Biotin)

GNAI3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

87U6, ARCND1

UniProt

P08754

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human GNAI3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TTGIVETHFTFKDLYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDY

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006487

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine PKB ELISA Kit
EPP0668 96 Tests

Porcine PKB ELISA Kit

Sign In for Pricing
View Details
CD82 Rabbit Monoclonal Antibody [KD Validated]
E46F62059 40 µL

CD82 Rabbit Monoclonal Antibody [KD Validated]

Sign In for Pricing
View Details
RB-PEG-N3 (MW 5000)
HY-D2886E 1 Each

RB-PEG-N3 (MW 5000)

Sign In for Pricing
View Details
PAX9 Rabbit Polyclonal Antibody (BF750)
orb2548340 100 µL

PAX9 Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
SM22 alpha (TAGLN) (NM_003186) Human Tagged ORF Clone Lentiviral Particle
RC215789L1V 200 µL

SM22 alpha (TAGLN) (NM_003186) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Lentiviral mouse Dsg3 shRNA (UAS) - Lentiviral mouse Dsg3 shRNA (UAS, RFP) (100)
GTR15275472 1 Vial

Lentiviral mouse Dsg3 shRNA (UAS) - Lentiviral mouse Dsg3 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details