Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GNAI3 Rabbit Polyclonal Antibody (FITC)

GNAI3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

87U6, ARCND1

UniProt

P08754

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human GNAI3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TTGIVETHFTFKDLYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDY

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006487

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant human COPS8 protein
ATGP1276-100 100 µg

Recombinant human COPS8 protein

Sign In for Pricing
View Details
CYCB2-1 Antibody
orb838742 2 mg

CYCB2-1 Antibody

Sign In for Pricing
View Details
Ccdc109b sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3293304 1.0 µg DNA

Ccdc109b sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Rabbit Monoclonal CD34 Antibody (HPCA1/1806R) [mFluor Violet 500 SE]
NBP2-54355MFV500 0.1 mL

Rabbit Monoclonal CD34 Antibody (HPCA1/1806R) [mFluor Violet 500 SE]

Sign In for Pricing
View Details
STK40, CT (Sugen Kinase 495, SgK495, SINK-homologous Serine/Threonine-protein Kinase, Serine/Threonine-protein Kinase 40, SGK495, SHIK) (MaxLight 750)
MBS6501252-01 0.1 mL

STK40, CT (Sugen Kinase 495, SgK495, SINK-homologous Serine/Threonine-protein Kinase, Serine/Threonine-protein Kinase 40, SGK495, SHIK) (MaxLight 750)

Sign In for Pricing
View Details
STK40, CT (Sugen Kinase 495, SgK495, SINK-homologous Serine/Threonine-protein Kinase, Serine/Threonine-protein Kinase 40, SGK495, SHIK) (MaxLight 750)
MBS6501252-02 5x 0.1 mL

STK40, CT (Sugen Kinase 495, SgK495, SINK-homologous Serine/Threonine-protein Kinase, Serine/Threonine-protein Kinase 40, SGK495, SHIK) (MaxLight 750)

Sign In for Pricing
View Details