Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LAMP1 Rabbit Polyclonal Antibody (Biotin)

LAMP1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

LAMPA, CD107a, LGP120

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human LAMP1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NMTFDLPSDATVVLNRSSCGKENTSDPSLVIAFGRGHTLTLNFTRNATRY

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Porcine, Rabbit

Tested Applications

IHC, WB

NCBI Accession Number

AAF66141

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAF15 Antibody
E51A03982 100 µL

TAF15 Antibody

Sign In for Pricing
View Details
Rabbit Monoclonal ErbB2/Her2 Antibody (ERBB2/7158R) [Alexa Fluor 594]
NBP3-24037AF594 0.1 mL

Rabbit Monoclonal ErbB2/Her2 Antibody (ERBB2/7158R) [Alexa Fluor 594]

Sign In for Pricing
View Details
Plant Enhancer of Zeste Homolog 2 (EZH2) ELISA Kit
MBS9379132 Inquire

Plant Enhancer of Zeste Homolog 2 (EZH2) ELISA Kit

Sign In for Pricing
View Details
HLA-DRB (LN-3 + HLA-DRB/1067), 1mg/mL
BNUM1208-50 1x 50 µL

HLA-DRB (LN-3 + HLA-DRB/1067), 1mg/mL

Sign In for Pricing
View Details
Conjugated STK3 Rabbit mAb
C52599 100 µL

Conjugated STK3 Rabbit mAb

Sign In for Pricing
View Details
Rat aldosterone (ALD) ELISA Kit
201-11-0517 96 Tests

Rat aldosterone (ALD) ELISA Kit

Sign In for Pricing
View Details