Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LAMP1 Rabbit Polyclonal Antibody (FITC)

LAMP1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

LAMPA, CD107a, LGP120

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human LAMP1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NMTFDLPSDATVVLNRSSCGKENTSDPSLVIAFGRGHTLTLNFTRNATRY

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Porcine, Rabbit

Tested Applications

IHC, WB

NCBI Accession Number

AAF66141

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Escherichia coli O157:H7 Acyl carrier protein phosphodiesterase (acpH)
MBS1330962-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O157:H7 Acyl carrier protein phosphodiesterase (acpH)

Sign In for Pricing
View Details
Recombinant Escherichia coli O157:H7 Acyl carrier protein phosphodiesterase (acpH)
MBS1330962-02 0.1 mg (E-Coli)

Recombinant Escherichia coli O157:H7 Acyl carrier protein phosphodiesterase (acpH)

Sign In for Pricing
View Details
Recombinant Escherichia coli O157:H7 Acyl carrier protein phosphodiesterase (acpH)
MBS1330962-03 0.02 mg (Yeast)

Recombinant Escherichia coli O157:H7 Acyl carrier protein phosphodiesterase (acpH)

Sign In for Pricing
View Details
Recombinant Escherichia coli O157:H7 Acyl carrier protein phosphodiesterase (acpH)
MBS1330962-04 0.1 mg (Yeast)

Recombinant Escherichia coli O157:H7 Acyl carrier protein phosphodiesterase (acpH)

Sign In for Pricing
View Details
Recombinant Escherichia coli O157:H7 Acyl carrier protein phosphodiesterase (acpH)
MBS1330962-05 0.02 mg (Baculovirus)

Recombinant Escherichia coli O157:H7 Acyl carrier protein phosphodiesterase (acpH)

Sign In for Pricing
View Details
Recombinant Escherichia coli O157:H7 Acyl carrier protein phosphodiesterase (acpH)
MBS1330962-06 0.02 mg (Mammalian-Cell)

Recombinant Escherichia coli O157:H7 Acyl carrier protein phosphodiesterase (acpH)

Sign In for Pricing
View Details