Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYD88 Rabbit Polyclonal Antibody (FITC)

MYD88 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

IMD68, MYD88D

UniProt

Q99836

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human MYD88

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: AEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDD

Field of Research

Infectious Disease & Virology

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPA70/RPA1 (E7T4Y) Rabbit Monoclonal Antibody
CST 42206S 100 µL

RPA70/RPA1 (E7T4Y) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to Ring Box Protein 1 (RBX1)
MBS2147007-01 0.1 mL

APC-Linked Monoclonal Antibody to Ring Box Protein 1 (RBX1)

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to Ring Box Protein 1 (RBX1)
MBS2147007-02 0.2 mL

APC-Linked Monoclonal Antibody to Ring Box Protein 1 (RBX1)

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to Ring Box Protein 1 (RBX1)
MBS2147007-03 0.5 mL

APC-Linked Monoclonal Antibody to Ring Box Protein 1 (RBX1)

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to Ring Box Protein 1 (RBX1)
MBS2147007-04 1 mL

APC-Linked Monoclonal Antibody to Ring Box Protein 1 (RBX1)

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to Ring Box Protein 1 (RBX1)
MBS2147007-05 5 mL

APC-Linked Monoclonal Antibody to Ring Box Protein 1 (RBX1)

Sign In for Pricing
View Details