Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATG16L1 Rabbit Polyclonal Antibody (FITC)

ATG16L1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

IBD10, WDR30, APG16L, ATG16A, ATG16L

UniProt

Q676U5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ATG16L1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TRRSVSSFPVPQDNVDTHPGSGKEVRVPATALCVFDAHDGEVNAVQFSPG

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_942593

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Mucin-5 Subtype Ac ELISA Kit
MBS042221-01 48 Well

Sheep Mucin-5 Subtype Ac ELISA Kit

Sign In for Pricing
View Details
Sheep Mucin-5 Subtype Ac ELISA Kit
MBS042221-02 96 Well

Sheep Mucin-5 Subtype Ac ELISA Kit

Sign In for Pricing
View Details
Sheep Mucin-5 Subtype Ac ELISA Kit
MBS042221-03 5x 96 Well

Sheep Mucin-5 Subtype Ac ELISA Kit

Sign In for Pricing
View Details
Sheep Mucin-5 Subtype Ac ELISA Kit
MBS042221-04 10x 96 Well

Sheep Mucin-5 Subtype Ac ELISA Kit

Sign In for Pricing
View Details
Human RENBP qPCR Primer Pair
QH21529S 200 Tests

Human RENBP qPCR Primer Pair

Sign In for Pricing
View Details
Atp6V0A2 Polyclonal Antibody
CAC10557-01 50 µg

Atp6V0A2 Polyclonal Antibody

Sign In for Pricing
View Details