Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GOPC Rabbit Polyclonal Antibody (FITC)

GOPC Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CAL, FIG, PIST, GOPC1, dJ94G16.2

UniProt

Q9HD26

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human GOPC

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QLEAEIHLHRHKTVIRACRGRNDLKRPMQAPPGHDQDSLKKSQGVGPIRK

Field of Research

Neuroscience

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_065132

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUDEN, CT (AP5M1, C14orf108, MUDENG, AP-5 complex subunit mu-1, Adapter-related protein complex 5 mu subunit, Mu-2-related death-inducing protein, Putative HIV-1 infection-related protein) (MaxLight 550)
MBS6322974-01 0.1 mL

MUDEN, CT (AP5M1, C14orf108, MUDENG, AP-5 complex subunit mu-1, Adapter-related protein complex 5 mu subunit, Mu-2-related death-inducing protein, Putative HIV-1 infection-related protein) (MaxLight 550)

Sign In for Pricing
View Details
MUDEN, CT (AP5M1, C14orf108, MUDENG, AP-5 complex subunit mu-1, Adapter-related protein complex 5 mu subunit, Mu-2-related death-inducing protein, Putative HIV-1 infection-related protein) (MaxLight 550)
MBS6322974-02 5x 0.1 mL

MUDEN, CT (AP5M1, C14orf108, MUDENG, AP-5 complex subunit mu-1, Adapter-related protein complex 5 mu subunit, Mu-2-related death-inducing protein, Putative HIV-1 infection-related protein) (MaxLight 550)

Sign In for Pricing
View Details
Recombinant Rat Heat shock protein HSP 90-alpha (Hsp90aa1)
orb2986145-01 20 µg

Recombinant Rat Heat shock protein HSP 90-alpha (Hsp90aa1)

Sign In for Pricing
View Details
Recombinant Rat Heat shock protein HSP 90-alpha (Hsp90aa1)
orb2986145-02 100 µg

Recombinant Rat Heat shock protein HSP 90-alpha (Hsp90aa1)

Sign In for Pricing
View Details
Recombinant Rat Heat shock protein HSP 90-alpha (Hsp90aa1)
orb2986145-03 1 mg

Recombinant Rat Heat shock protein HSP 90-alpha (Hsp90aa1)

Sign In for Pricing
View Details
KCNK5 Recombinant Protein (Mouse)
RP145211 100 µg

KCNK5 Recombinant Protein (Mouse)

Sign In for Pricing
View Details