Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Srpx Rabbit Polyclonal Antibody (HRP)

Srpx Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Drs, DRS-1, DRS-2, drs-1, drs-2

UniProt

Q9R0M3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ALALQLRLLLRIPLYSFSMVVVDKHGMDKERYVSLVTPMALFNLIDTFPL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_058607

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gm13306 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
21819124 3x 1.0µg DNA

Gm13306 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Genesig kit for Zaire ebola virus 2014 variant, Easy
348435 1 Kit

Genesig kit for Zaire ebola virus 2014 variant, Easy

Sign In for Pricing
View Details
C-Jun (Ab-93) Antibody
21022-01 50 µL

C-Jun (Ab-93) Antibody

Sign In for Pricing
View Details
C-Jun (Ab-93) Antibody
21022-02 100 µL

C-Jun (Ab-93) Antibody

Sign In for Pricing
View Details
RPL23AP78 3'UTR GFP Stable Cell Line
TU071141 1.0 mL

RPL23AP78 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
ST8SIA2 ORF Vector (Human) (pORF)
45656011 1.0 µg DNA

ST8SIA2 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details