Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TM9SF1 Rabbit Polyclonal Antibody (HRP)

TM9SF1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MP70, HMP70

UniProt

Q86SZ6

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human TM9SF1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LVGFVAVILMRVLRNDLARYNLDEETTSAGSGDDFDQGDNGWKIIHTDVF

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001014842

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FYN Antibody, FITC conjugated
CSB-PA009101LC01HU-01 50 µg

FYN Antibody, FITC conjugated

Sign In for Pricing
View Details
FYN Antibody, FITC conjugated
CSB-PA009101LC01HU-02 100 µg

FYN Antibody, FITC conjugated

Sign In for Pricing
View Details
Rnf6 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4790605 3x 1.0 µg

Rnf6 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Casp7 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3726205 3x 1.0 µg

Casp7 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
TOB (TOB1) (NM_001243885) Human Untagged Clone
SC332052 10 µg

TOB (TOB1) (NM_001243885) Human Untagged Clone

Sign In for Pricing
View Details
Lentiviral human FBL sgRNA gene knockout kit - Lentiviral human FBL sgRNA gene knockout kit (25)
GTR15387438 1 Vial

Lentiviral human FBL sgRNA gene knockout kit - Lentiviral human FBL sgRNA gene knockout kit (25)

Sign In for Pricing
View Details