Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TM9SF1 Rabbit Polyclonal Antibody (HRP)

TM9SF1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MP70, HMP70

UniProt

Q86SZ6

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human TM9SF1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LVGFVAVILMRVLRNDLARYNLDEETTSAGSGDDFDQGDNGWKIIHTDVF

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001014842

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Bromo-2- (pyrrolidin-1-yl) pyridine
sc-322388A 5 g

3-Bromo-2- (pyrrolidin-1-yl) pyridine

Sign In for Pricing
View Details
Guinea pig 5-Hydroxyindoleacetic acid (5-HIAA) ELISA Kit
EIA05005Gu 1 Kit

Guinea pig 5-Hydroxyindoleacetic acid (5-HIAA) ELISA Kit

Sign In for Pricing
View Details
MICA, CT (MHC Class I Polypeptide-related Sequence A, MIC-A, PERB11.1) discontinued
M3886-75B 50 µg

MICA, CT (MHC Class I Polypeptide-related Sequence A, MIC-A, PERB11.1) discontinued

Sign In for Pricing
View Details
Mmp8 Mouse Pre-designed siRNA Set A
HY-RS08555 1 Set

Mmp8 Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
SRB4D Rabbit Polyclonal Antibody
BT-AP12789-01 20 µL

SRB4D Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SRB4D Rabbit Polyclonal Antibody
BT-AP12789-02 50 µL

SRB4D Rabbit Polyclonal Antibody

Sign In for Pricing
View Details