Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM166 Rabbit Polyclonal Antibody (FITC)

TMEM166 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FAM176A, TMEM166

UniProt

Q9H8M9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TMEM166

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: AALVIRISCHTDCRRRPGKKFLQDRESSSDSSDSEDGSEDTVSDLSVRRH

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_001128504

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Uncoated Human DKK1 (Dickkopf Related Protein 1) ELISA Kit
E-UNEL-H0248-01 5x 96 Tests

Uncoated Human DKK1 (Dickkopf Related Protein 1) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human DKK1 (Dickkopf Related Protein 1) ELISA Kit
E-UNEL-H0248-02 15x 96 Tests

Uncoated Human DKK1 (Dickkopf Related Protein 1) ELISA Kit

Sign In for Pricing
View Details
CD31 / PECAM-1 (Endothelial Cell Marker) (PECAM1/3526), CF568 conjugate, 0.1mg/mL
BNC683526-100 1x 100 µL

CD31 / PECAM-1 (Endothelial Cell Marker) (PECAM1/3526), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2-(1H-Imidazol-1-yl)acetic Acid Hydrochloride
TRC-I385638-2.5G 2.5 g

2-(1H-Imidazol-1-yl)acetic Acid Hydrochloride

Sign In for Pricing
View Details
Crebbp Mouse Gene Knockout Kit (CRISPR)
KN303812 1 Kit

Crebbp Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cpz Mouse Gene Knockout Kit (CRISPR)
KN503791 1 Kit

Cpz Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details