Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TP53INP2 Rabbit Polyclonal Antibody (Biotin)

TP53INP2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

DOR, PIGU, PINH, PIG-U, C20orf110, dJ1181N3.1

UniProt

Q8IXH6

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human TP53INP2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RLQRARQRAERHALSAKAVQRQNRARESRPRRSKNQSSFIYQPCQRQFNY

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_067025

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Abhd3 ORF Vector (Rat) (pORF)
11096016 1.0 µg DNA

Abhd3 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
BCR, Phosphorylated (Y177) (Breakpoint Cluster Region Protein, ALL, CML, PHL, BCR1, D22S11, D22S662) (MaxLight 490)
MBS6408440-01 0.1 mL

BCR, Phosphorylated (Y177) (Breakpoint Cluster Region Protein, ALL, CML, PHL, BCR1, D22S11, D22S662) (MaxLight 490)

Sign In for Pricing
View Details
BCR, Phosphorylated (Y177) (Breakpoint Cluster Region Protein, ALL, CML, PHL, BCR1, D22S11, D22S662) (MaxLight 490)
MBS6408440-02 5x 0.1 mL

BCR, Phosphorylated (Y177) (Breakpoint Cluster Region Protein, ALL, CML, PHL, BCR1, D22S11, D22S662) (MaxLight 490)

Sign In for Pricing
View Details
SKINTL CRISPR All-in-one AAV vector set (with saCas9)(Human)
43840151 3x 1.0 µg DNA

SKINTL CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Coronavirus (SARS-CoV Matrix), Recombinant
532198 100 µg

Coronavirus (SARS-CoV Matrix), Recombinant

Sign In for Pricing
View Details
EXD2 Antibody - middle region : HRP (ARP68298_P050-HRP)
ARP68298_P050-HRP 100 µL

EXD2 Antibody - middle region : HRP (ARP68298_P050-HRP)

Sign In for Pricing
View Details